Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264136, Anbieter: Anmelden zum Anzeigen
  • CSS
  • cmas
  • cmas1
  • si:dkey-183c2.1
  • wu:fj16c12
  • zgc:136241
  • AW208911
  • CMPNeu5Ac
  • D6Bwg0250e
  • cytidine monophosphate N-acetylneuraminic acid synthetase
  • cytidine monophosphate N-acetylneuraminic acid synthetase a
  • cytidine monophospho-N-acetylneuraminic acid synthetase
  • CMAS
  • Cmas
  • cmasa
  • cmas
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CMAS(cytidine monophosphate N-acetylneuraminic acid synthetase) The peptide sequence was selected from the N terminal of CMAS. Peptide sequence GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF.
Reinigung Immunogen affinity purified
Andere Bezeichnung CMAS (CMAS Antibody Abstract)
Hintergrund Gene Symbol: CMAS
Gen-ID 55907
UniProt Q8NFW8
Forschungsgebiet Signaling, Metabolism
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CMAS and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?