Clathrin, Light Chain B (CLTB) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264116, Anbieter: Anmelden zum Anzeigen
  • clcb
  • LCB
  • 2310046E19Rik
  • clathrin, light chain B L homeolog
  • clathrin light chain B
  • Clathrin light chain B
  • clathrin, light chain B
  • clathrin, light polypeptide (Lcb)
  • cltb.L
  • CLTB
  • clcb
  • Cltb
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to APLNR (apelin receptor) The peptide sequence was selected form the N terminal of APLNR. Peptide sequence NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLTB (CLTB Antibody Abstract)
Hintergrund Gene Symbol: APLNR
Gen-ID 187
UniProt P35414
Pathways Synaptic Membrane
Applikationshinweise Optimal working dilution should be determined by the investigator.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?