CLMN Antikörper (Calmin) (C-Term)

Details for Product anti-CLMN Antibody No. ABIN4263823, Anbieter: Anmelden zum Anzeigen
  • 9330188N17Rik
  • AI428889
  • AI788815
  • mKIAA1188
  • uncharacterized protein PFB0145c
  • calmin
  • LOC5569762
  • CpipJ_CPIJ015331
  • Clmn
  • CLMN
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the C terminal of human CLMN. Peptide sequence LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLMN
Hintergrund Gene Symbol: CLMN
Gen-ID 79789
NCBI Accession NP_079010
Applikations-hinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CLMN and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?