Calmegin Antikörper (CLGN) (N-Term)

Details for Product anti-CLGN Antibody No. ABIN4263809, Anbieter: Anmelden zum Anzeigen
  • canx
  • fj49d10
  • wu:fj24b04
  • wu:fj49d10
  • zgc:153946
  • CLGN
  • clgn
  • clnx
  • cnx
  • 4930459O04Rik
  • AI528775
  • Cln
  • calmegin
  • calnexin L homeolog
  • CLGN
  • clgn
  • canx.L
  • Clgn
Dieser Calmegin Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CLGN(calmegin) The peptide sequence was selected from the N terminal of CLGN. Peptide sequence YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL.
Reinigung Protein A purified
Andere Bezeichnung CLGN (CLGN Antibody Abstract)
Hintergrund Gene Symbol: CLGN
Molekulargewicht Theoretical MW: 70 kDa
Gen-ID 1047
UniProt O14967
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLGN and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Calmegin (CLGN) (N-Term) antibody (ABIN4263809) Western Blot: CLGN Antibody [NBP1-62547] - Titration: 2.5ug/ml Positive Control: HepG...
Haben Sie etwas anderes gesucht?