Chloride Channel 1, Skeletal Muscle (CLCN1) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263662, Anbieter: Anmelden zum Anzeigen
  • CLCN1
  • si:dkey-14o18.5
  • Clc-1
  • Clc1
  • SMCC1
  • adr
  • mto
  • myotonia
  • nmf355
  • SMCC
  • CLC1
  • chloride voltage-gated channel 1
  • chloride channel, voltage-sensitive 1a
  • chloride channel protein 1
  • chloride channel, voltage-sensitive 1
  • CLCN1
  • clcn1a
  • LOC100550479
  • LOC703944
  • Clcn1
Maus, Ratte (Rattus)
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to Clcn1 (chloride channel 1) The peptide sequence was selected from the C terminal of Clcn1. Peptide sequence SSIFQRLLHCLLGKAHSTKKKITQDSTDLVDNMSPEEIEAWEREQLSQPV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CLCN1 (CLCN1 Antibody Abstract)
Hintergrund Gene Symbol: CLCN1
Molekulargewicht Theoretical MW: 110 kDa
Gen-ID 1180
Applikationshinweise Western Blot 1:100-1:2000, ImmunohistochemistryThis is a rabbit polyclonal antibody against Clcn1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?