Claudin 16 (CLDN16) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4263650, Anbieter: Anmelden zum Anzeigen
  • CLDN16
  • HOMG3
  • PCLN1
  • claudin-16
  • Pcln1
  • claudin 16
  • CLDN16
  • Cldn16
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CLDN16 (claudin 16) The peptide sequence was selected from the C terminal of CLDN16. Peptide sequence FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA.
Reinigung Protein A purified
Andere Bezeichnung Claudin-16 (CLDN16 Antibody Abstract)
Hintergrund Gene Symbol: CLDN16
Gen-ID 10686
UniProt Q9Y5I7
Pathways Hepatitis C
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CLDN16 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?