COLEC12 Antikörper (Collectin Sub-Family Member 12) (N-Term)

Details for Product anti-COLEC12 Antibody No. ABIN4263639, Anbieter: Anmelden zum Anzeigen
  • COLEC12
  • CLP1
  • NSR2
  • SCARA4
  • SRCL
  • CL-P1
  • Scara4
  • hm:zeh0853
  • id:ibd2826
  • sb:cb377
  • si:ch211-212m21.5
  • collectin subfamily member 12
  • collectin sub-family member 12
  • COLEC12
  • colec12
  • Colec12
Dieser COLEC12 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is CLP1 - N-terminal region. Peptide sequence MRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAITSRLADVFNQRCE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CL-P1/COLEC12 (COLEC12 Antibody Abstract)
Hintergrund Gene Symbol: CLP1
Molekulargewicht Theoretical MW: 41 kDa
Gen-ID 10978
NCBI Accession NP_001136069
Pathways Activation of Innate immune Response
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?