CMTM8 Antikörper (CKLF-Like MARVEL Transmembrane Domain Containing 8) (N-Term)

Details for Product anti-CMTM8 Antibody No. ABIN4263614, Anbieter: Anmelden zum Anzeigen
  • MGC82744
  • marveld1
  • CKLFSF8-V2
  • 2700018N07Rik
  • AA408515
  • Cklfsf8
  • CKLF-like MARVEL transmembrane domain containing 8 L homeolog
  • CKLF like MARVEL transmembrane domain containing 8
  • CKLF-like MARVEL transmembrane domain containing 8
  • cmtm8.L
  • CMTM8
  • cmtm8
  • Cmtm8
Dieser CMTM8 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to LAYN(layilin) The peptide sequence was selected form the N terminal of LAYN. Peptide sequence CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cklfsf8 (CMTM8 Antibody Abstract)
Hintergrund Gene Symbol: LAYN
Gen-ID 143903
Applikations-hinweise Optimal working dilution should be determined by the investigator.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?