Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263612, Anbieter: Anmelden zum Anzeigen
  • CKIP-1
  • OC120
  • 2810052M02Rik
  • Ckip1
  • JZA-20
  • Jza2
  • RGD1311487
  • pleckstrin homology domain containing O1
  • pleckstrin homology domain containing, family O member 1
  • Plekho1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to PLEKHO1 (pleckstrin homology domain containing, family O member 1) The peptide sequence was selected from the N terminal of PLEKHO1. Peptide sequence MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG.
Reinigung Immunogen affinity purified
Andere Bezeichnung CKIP-1 (PLEKHO1 Antibody Abstract)
Hintergrund Gene Symbol: PLEKHO1
Gen-ID 51177
UniProt Q53GL0
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PLEKHO1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?