Casein Kinase 1, gamma 3 (CSNK1G3) Antikörper

Details zu Produkt Nr. ABIN4263606, Anbieter: Anmelden zum Anzeigen
  • CKI-gamma 3
  • CSNK1G3L
  • 3300002K07Rik
  • C330049O21Rik
  • casein kinase 1 gamma 3
  • casein kinase 1 gamma 3 L homeolog
  • casein kinase 1, gamma 3
  • CSNK1G3
  • csnk1g3
  • csnk1g3.L
  • Csnk1g3
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP.
Reinigung Immunogen affinity purified
Andere Bezeichnung CKI gamma 3 (CSNK1G3 Antibody Abstract)
Hintergrund Gene Symbol: CSNK1G3
Gen-ID 1456
UniProt Q9Y6M4
Pathways Hedgehog Signalweg
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSNK1G3 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?