Mast Cell Protease 1-Like 1 (MCPT1L1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263495, Anbieter: Anmelden zum Anzeigen
  • CLIP protein
  • Mcpt1
  • rMCP-1
  • rMCP-I
  • mast cell protease 1-like 1
  • Mcpt1l1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL.
Reinigung Immunogen affinity purified
Andere Bezeichnung Chymotrypsin-Like Protease (MCPT1L1 Antibody Abstract)
Hintergrund Gene Symbol: CTRL
Gen-ID 1506
UniProt P40313
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CTRL and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungs-mittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?