CHRAC1 Antikörper (Chromatin Accessibility Complex 1) (N-Term)

Details for Product anti-CHRAC1 Antibody No. ABIN4263425, Anbieter: Anmelden zum Anzeigen
  • chrac1
  • CHRAC1
  • CHARC1
  • CHARC15
  • CHRAC-1
  • CHRAC-15
  • CHRAC15
  • YCL1
  • 2410152E03Rik
  • 2810406L04Rik
  • chromatin accessibility complex 1
  • chrac1
  • CHRAC1
  • Chrac1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CHRAC1. Peptide sequence SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSE.
Reinigung Immunogen affinity purified
Andere Bezeichnung CHRAC1 (CHRAC1 Antibody Abstract)
Hintergrund Gene Symbol: CHRAC1
Molekulargewicht Theoretical MW: 15 kDa
Gen-ID 54108
NCBI Accession NP_059140
Applikations-hinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CHRAC1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungs-mittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?