Chimerin (Chimaerin) 2 (CHN2) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4263032, Anbieter: Anmelden zum Anzeigen
  • 1700026N20Rik
  • 4930557O16Rik
  • Bch
  • BCH
  • CHN2-3
  • chimerin 2
  • chimerin 2 L homeolog
  • chn2
  • CHN2
  • Chn2
  • chn2.L
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CHN2(chimerin (chimaerin) 2) The peptide sequence was selected from the N terminal of CHN2. Peptide sequence NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC.
Reinigung Immunogen affinity purified
Andere Bezeichnung Chimaerin 2 (CHN2 Antibody Abstract)
Hintergrund Gene Symbol: CHN2
Molekulargewicht Theoretical MW: 38 kDa
Gen-ID 1124
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CHN2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?