CSGALNACT1 Antikörper (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1) (C-Term)

Details for Product anti-CSGALNACT1 Antibody No. ABIN4263022, Anbieter: Anmelden zum Anzeigen
  • CSGalNAcT-1
  • ChGn
  • beta4GalNAcT
  • CHGN
  • 4732435N03Rik
  • Chgn
  • RGD1307618
  • chondroitin sulfate N-acetylgalactosaminyltransferase 1
  • csgalnact1
  • Csgalnact1
  • LOC100517735
Dieser CSGALNACT1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CHGN The peptide sequence was selected from the C terminal of CHGN. Peptide sequence DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT.
Reinigung Immunogen affinity purified
Andere Bezeichnung ChGn (CSGALNACT1 Antibody Abstract)
Hintergrund Gene Symbol: CSGALNACT1
Gen-ID 55790
UniProt Q8TDX6
Pathways Glycosaminoglycan Metabolic Process
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against ChGn and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?