CES5A Antikörper (Carboxylesterase 5A)

Details for Product anti-CES5A Antibody No. ABIN4262919, Anbieter: Anmelden zum Anzeigen
  • CES7
  • Bmae47
  • cce-5a
  • Bmcce-5a
  • jhe-lp5l
  • jhe-lp5s
  • CES4C1
  • CES5
  • 1700081L16Rik
  • 1700122C07Rik
  • BB081581
  • Ces7
  • Gm503
  • cauxin
  • Ces5
  • LOC445455
  • carboxylesterase 5A
  • alpha-esterase 47
  • CES5A
  • ae47
  • Ces5a
Dieser CES5A Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the middle region of CES7. Peptide sequence LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF.
Reinigung Immunogen affinity purified
Andere Bezeichnung CES7 (CES5A Antibody Abstract)
Hintergrund Gene Symbol: CES5A
Molekulargewicht Theoretical MW: 58 kDa
Gen-ID 221223
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CES7 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?