CEP55 Antikörper (Centrosomal Protein 55kDa) (N-Term)

Details for Product anti-CEP55 Antibody No. ABIN4262901, Anbieter: Anmelden zum Anzeigen
  • C10orf3
  • CT111
  • URCC6
  • RGD1305340
  • 1200008O12Rik
  • 2700032M20Rik
  • centrosomal protein 55
  • CEP55
  • Cep55
Dieser CEP55 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the N terminal of CEP55. Peptide sequence MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK.
Reinigung Immunogen affinity purified
Andere Bezeichnung CEP55 (CEP55 Antibody Abstract)
Hintergrund Gene Symbol: CEP55
Gen-ID 55165
UniProt Q53EZ4
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CEP55 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?