Centromere Protein N (CENPN) Antikörper

Details zu Produkt Nr. ABIN4262885, Anbieter: Anmelden zum Anzeigen
  • unm
  • hi3634
  • un-named
  • zgc:92188
  • id:ibd2033
  • si:dz241h12.3
  • si:busm1-241h12.3
  • cenpn-a
  • cenpn-B
  • cenp-n
  • BM039
  • C16orf60
  • CENP-N
  • ICEN32
  • 2610510J17Rik
  • AI426416
  • AW545024
  • Da2-27
  • Da2-4
  • RGD1310953
  • centromere protein N
  • centromere protein N S homeolog
  • centromere protein N L homeolog
  • cenpn
  • cenpn.S
  • cenpn.L
  • Cenpn
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS.
Reinigung Immunogen affinity purified
Andere Bezeichnung CENPN (CENPN Antibody Abstract)
Hintergrund Gene Symbol: CENPN
Molekulargewicht Theoretical MW: 41 kDa
Gen-ID 55839
NCBI Accession NP_001094095
Applikationshinweise Western Blot 1:1000, Immunocytochemistry/Immunofluorescence 1:10-1:2000This is a rabbit polyclonal antibody against CENPN and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?