Cell Cycle Exit and Neuronal Differentiation 1 (CEND1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4262878, Anbieter: Anmelden zum Anzeigen
  • C9orf155
  • GOLPH2
  • GP73
  • PSEC0257
  • bA379P1.3
  • BM88
  • 1500001H12Rik
  • AI415214
  • C38
  • RGD1309401
  • golgi membrane protein 1
  • cell cycle exit and neuronal differentiation 1
  • GOLM1
  • CEND1
  • Cend1
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to GOLM1(golgi membrane protein 1) The peptide sequence was selected form the N terminal of GOLM1. Peptide sequence RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS.
Reinigung Immunogen affinity purified
Andere Bezeichnung CEND1 (CEND1 Antibody Abstract)
Hintergrund Gene Symbol: GOLM1
Gen-ID 51280
UniProt Q8NBJ4
Applikationshinweise Western BlotThis is a rabbit polyclonal antibody against GOLM1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?