CEACAM19 Antikörper (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 19)

Details for Product anti-CEACAM19 Antibody No. ABIN4262816, Anbieter: Anmelden zum Anzeigen
  • CEAL1
  • C130022P09Rik
  • carcinoembryonic antigen related cell adhesion molecule 19
  • carcinoembryonic antigen-related cell adhesion molecule 19
  • CEACAM19
  • Ceacam19
Dieser CEACAM19 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CEACAM19(carcinoembryonic antigen-related cell adhesion molecule 19) The peptide sequence was selected from the middle region of CEACAM19. Peptide sequence MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLP
Reinigung Immunogen affinity purified
Andere Bezeichnung CEACAM-19
Hintergrund Gene Symbol: CEACAM19
Molekulargewicht Theoretical MW: 33 kDa
Gen-ID 56971
Applikations-hinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CEACAM19 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?