Caudal Type Homeobox 1 (CDX1) Antikörper

Details zu Produkt Nr. ABIN4262747, Anbieter: Anmelden zum Anzeigen
  • cdx-1
  • xcad2
  • xtcad2
  • CDX1
  • Cdx
  • Cdx-1
  • CDX-A
  • CDXA
  • CHox-cad
  • xCAD2
  • caudal type homeobox 1
  • caudal type homeo box 1
  • caudal type homeobox 1 S homeolog
  • cdx1
  • CDX1
  • Cdx1
  • cdx1.S
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide towards Cdx1. Peptide sequence ERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSGPPLG.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cdx1 (CDX1 Antibody Abstract)
Hintergrund Gene Symbol: CDX1
Gen-ID 1044
NCBI Accession NP_034010
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Cdx1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?