CD99 Molecule-Like 2 (CD99L2) Antikörper

Details zu Produkt Nr. ABIN4262515, Anbieter: Anmelden zum Anzeigen
  • AW548191
  • Mic2l1
  • Xap89
  • CD99B
  • MIC2L1
  • vms-tm2
  • CD99 antigen-like 2
  • CD99 molecule like 2
  • CD99 molecule-like 2
  • Cd99l2
  • CD99L2
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the middle region of human CD99L2The immunogen for this antibody is CD99L2. Peptide sequence RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG.
Reinigung Immunogen affinity purified
Andere Bezeichnung CD99-L2 (CD99L2 Antibody Abstract)
Hintergrund Gene Symbol: CD99L2
Molekulargewicht Theoretical MW: 23 kDa
Gen-ID 83692
NCBI Accession NP_604395
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CD99L2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?