CD58 Antikörper (CD58 Molecule) (C-Term)

Details for Product anti-CD58 Antibody No. ABIN4261630, Anbieter: Anmelden zum Anzeigen
  • LFA-3
  • LFA3
  • ag3
  • CD58 molecule
  • CD58
Dieser CD58 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is LFA3 - C-terminal region. Peptide sequence SIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTK.
Reinigung Immunogen affinity purified
Andere Bezeichnung CD58/LFA-3 (CD58 Antibody Abstract)
Hintergrund Gene Symbol: CD58
Molekulargewicht Theoretical MW: 27 kDa
Gen-ID 965
NCBI Accession NP_001138294
Applikations-hinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?