Cyclin Y Antikörper (CCNY)

Details for Product anti-CCNY Antibody No. ABIN4258846, Anbieter: Anmelden zum Anzeigen
Antigen
  • CG14939
  • Dcyclin Y
  • Dmel\\CG14939
  • anon-WO0118547.165
  • i182
  • C10orf9
  • CBCP1
  • CCNX
  • CFP1
  • 1700025H17Rik
  • 3110050L10Rik
  • 4631402G10Rik
  • 5730405I09Rik
  • RGD1565969
  • cyclin Y
  • Cyclin Y
  • cyclin Y like 1
  • CCNY
  • CycY
  • Ccny
  • CCNYL1
Reaktivität
Human
49
34
23
3
3
3
3
2
1
1
1
1
Wirt
Kaninchen
46
3
Klonalität
Polyklonal
Konjugat
Dieser Cyclin Y Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
35
19
13
5
3
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CCNY(cyclin Y) The peptide sequence was selected from the middle region of CCNY. Peptide sequence DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY.
Reinigung Immunogen affinity purified
Andere Bezeichnung CCNY (CCNY Antibody Abstract)
Hintergrund Gene Symbol: CCNY
Gen-ID 219771
UniProt Q8ND76
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CCNY and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?