CCL16/HCC-4/LEC (N-Term) Antikörper

Details zu Produkt Nr. ABIN4258661, Anbieter: Anmelden zum Anzeigen
  • CKb12
  • HCC-4
  • LCC-1
  • LEC
  • LMC
  • Mtn-1
  • NCC-4
  • NCC4
  • SCYA16
  • SCYL4
  • C-C motif chemokine ligand 16
  • CCL16
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to the N terminal of CCL16. Immunizing peptide sequence SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL.
Reinigung Immunogen affinity purified
Hintergrund Gene Symbol: CCL16
Molekulargewicht Theoretical MW: 11 kDa
Gen-ID 6360
UniProt O15467
Applikationshinweise Western Blot 1.0 μg/mLThis is a rabbit polyclonal antibody against CCL16 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?