UHRF1 Antikörper (N-Term)
-
- Target Alle UHRF1 Antikörper anzeigen
- UHRF1 (Ubiquitin-Like, Containing PHD and RING Finger Domains, 1 (UHRF1))
-
Bindungsspezifität
- AA 14-51, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UHRF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human.
- Sequenz
- HTVDSLSRLT KVEELRRKIQ ELFHVEPGLQ RLFYRGKQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human.
Gene Name: ubiquitin-like with PHD and ring finger domains 1
Protein Name: E3 ubiquitin-protein ligase UHRF1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product UHRF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- UHRF1 (Ubiquitin-Like, Containing PHD and RING Finger Domains, 1 (UHRF1))
- Andere Bezeichnung
- UHRF1 (UHRF1 Produkte)
- Synonyme
- ICBP90 antikoerper, Np95 antikoerper, RNF106 antikoerper, hNP95 antikoerper, hUHRF1 antikoerper, AL022808 antikoerper, NP95 antikoerper, fb97f09 antikoerper, wu:fb97f09 antikoerper, zgc:63539 antikoerper, UHRF1 antikoerper, ubiquitin like with PHD and ring finger domains 1 antikoerper, ubiquitin-like, containing PHD and RING finger domains, 1 antikoerper, ubiquitin-like with PHD and ring finger domains 1 antikoerper, UHRF1 antikoerper, Uhrf1 antikoerper, uhrf1 antikoerper
- Hintergrund
-
Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.
Synonyms: Ac2-121 antibody|AL022808 antibody|E3 ubiquitin-protein ligase UHRF1 antibody|EC 6.3.2.- antibody|FLJ21925 antibody|hNP95 antibody| hUHRF1 antibody|HuNp95 antibody|ICBP90 antibody|Inverted CCAAT box binding protein of 90 kDa antibody|Inverted CCAAT box binding protein, 90-kD antibody|Inverted CCAAT box-binding protein of 90 kDa antibody|Liver regeneration-related protein LRRG126 antibody| MGC138707 antibody|NP95 antibody|Nuclear phosphoprotein, 95-KD antibody|Nuclear protein 95 antibody|Nuclear zinc finger protein Np95 antibody|RING finger protein 106 antibody|RNF106 antibody|Transcription factor ICBP90 antibody|Ubiquitin like containing PHD and RING finger domains protein 1 antibody|Ubiquitin like PHD and RING finger domain containing protein 1 antibody|Ubiquitin-like PHD and RING finger domain-containing protein 1 antibody|Ubiquitin-like protein containing PHD and RING finger domains 1 antibody|Ubiquitin-like with PHD and ring finger domains 1 antibody|Ubiquitin-like, containing PHD and RING finger domains, 1 antibody|Ubiquitin-like-containing PHD and RING finger domains protein 1 antibody|UHRF1 antibody|UHRF1_HUMAN antibody - Gen-ID
- 29128
- UniProt
- Q96T88
-