TAP1 Antikörper (Middle Region)

Produktnummer ABIN3043943

Produktdetails anti-TAP1 Antikörper

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Bindungsspezifität: AA 438-471, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.

Sequenz: RSFANEEGEA QKFREKLQEI KTLNQKEAVA YAVN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.
Gene Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name: Antigen peptide transporter 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Andere Bezeichnung: TAP1 (TAP1 Produkte)

Synonyme: ABC17 antikoerper, ABCB2 antikoerper, APT1 antikoerper, D6S114E antikoerper, PSF-1 antikoerper, PSF1 antikoerper, RING4 antikoerper, TAP1*0102N antikoerper, TAP1N antikoerper, abc17 antikoerper, abcb2 antikoerper, apt1 antikoerper, psf1 antikoerper, ring4 antikoerper, tap1a antikoerper, tap1n antikoerper, Abcb2 antikoerper, Ham-1 antikoerper, Ham1 antikoerper, MTP1 antikoerper, TAP antikoerper, Tap-1 antikoerper, Y3 antikoerper, Cim antikoerper, transporter 1, ATP binding cassette subfamily B member antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antikoerper, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antikoerper, TAP1 antikoerper, tap1.L antikoerper, Tap1 antikoerper

Hintergrund: Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: ABC 17 antibody|ABC transporter MHC 1 antibody|ABC17 antibody|ABCB 2 antibody|ABCB2 antibody|Antigen peptide transporter 1 antibody| APT 1 antibody|APT1 antibody|ATP binding cassette sub family B (MDR/TAP) member 2 antibody|ATP binding cassette sub family B member 2 antibody|ATP binding cassette transporter antibody|ATP-binding cassette sub-family B member 2 antibody|D6S114E antibody|FLJ26666 antibody|FLJ41500 antibody|Peptide supply factor 1 antibody|Peptide transporter involved in antigen processing 1 antibody|Peptide transporter PSF 1 antibody|Peptide transporter PSF1 antibody|Peptide transporter TAP 1 antibody|Peptide transporter TAP1 antibody|PSF 1 antibody|PSF-1 antibody|PSF1 antibody|Really interesting new gene 4 protein antibody|RING 4 antibody|RING4 antibody|TAP 1 antibody| TAP1 antibody|TAP1*0102N antibody|TAP1_HUMAN antibody|TAP1N antibody|Transporter 1 ATP binding cassette sub family B (MDR/TAP) antibody|Transporter 1 ATP binding cassette sub family B antibody|Transporter associated with antigen processing antibody|Transporter ATP binding cassette major histocompatibility complex 1 antibody|Y3 antibody

Gen-ID: 6890

UniProt: Q03518

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process