NPY Antikörper (Middle Region)

Produktnummer ABIN3043892

Produktdetails anti-NPY Antikörper

Target: NPY (Neuropeptide Y (NPY))

Bindungsspezifität: AA 29-64, Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NPY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: YPSKPDNPGE DAPAEDMARY YSALRHYINL ITRQRY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: neuropeptide Y
Protein Name: Pro-neuropeptide Y

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Neuropeptide Y is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-NPY Antikörper (ABIN3043892)

Fan, Mu, Qin, Bi, Pei: "Different effects of implanting sensory nerve or blood vessel on the vascularization, neurotization, and osteogenesis of tissue-engineered bone in vivo." in: BioMed research international, Vol. 2014, pp. 412570, (2015) (PubMed).

Song, Yang, Zhong, Chen: "Sericin protects against diabetes-induced injuries in sciatic nerve and related nerve cells." in: Neural regeneration research, Vol. 8, Issue 6, pp. 506-13, (2014) (PubMed).

Wang, Zhou, Zhang, Wu, Zhang, Zhang: "Identification and localization of gastrointestinal hormones in the skin of the bullfrog Rana catesbeiana during periods of activity and hibernation." in: Acta histochemica, Vol. 116, Issue 8, pp. 1418-26, (2014) (PubMed).

Huang, Zhu, Zhang, Zhu, Liu, Zhu, Wang, Li, Yang, Dong, Liu, Chen, Zhang, Yang, Deng, Fan, Wang, Liu, Ma, Fu, Wu: "S100+ cells: a new neuro-immune cross-talkers in lymph organs." in: Scientific reports, Vol. 3, pp. 1114, (2013) (PubMed).

Wang, Chen, Yue, Bai, Kou, Jin: "Xiaoyaosan decoction regulates changes in neuropeptide y and leptin receptor in the rat arcuate nucleus after chronic immobilization stress." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2012, pp. 381278, (2012) (PubMed).

Details zu NPY

Target: NPY (Neuropeptide Y (NPY))

Andere Bezeichnung: NPY (NPY Produkte)

Synonyme: 0710005A05Rik antikoerper, PYY4 antikoerper, NPY02 antikoerper, RATNPY antikoerper, RATNPY02 antikoerper, si:dkey-22m8.5 antikoerper, npy antikoerper, npyb antikoerper, preproNPY antikoerper, pyy4 antikoerper, xnpy antikoerper, npya antikoerper, MGC86288 antikoerper, prepronpy antikoerper, NPY antikoerper, NPY1 antikoerper, neuropeptide Y antikoerper, neuropeptide Y S homeolog antikoerper, neuropeptide Y L homeolog antikoerper, Npy antikoerper, NPY antikoerper, npy antikoerper, npy.S antikoerper, npy.L antikoerper, LOC100533423 antikoerper

Hintergrund: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.

Synonyms: C-flanking peptide of NPY antibody|CPON antibody|Neuropeptide tyrosine antibody|Neuropeptide Y precursor antibody|NPY antibody|NPY_HUMAN antibody|Pro neuropeptide Y antibody|PYY 4 antibody|PYY4 antibody|Y Neuropeptide antibody

Gen-ID: 4852

UniProt: P01303

Pathways: Feeding Behaviour