FABP4 Antikörper (N-Term)

Produktnummer ABIN3043827

Produktdetails anti-FABP4 Antikörper

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Bindungsspezifität: AA 10-40, N-Term

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KLVSSENFDD YMKEVGVGFA TRKVAGMAKP N

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 4, adipocyte
Protein Name: Fatty acid-binding protein, adipocyte

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FABP4

Target: FABP4 (Fatty Acid Binding Protein 4, Adipocyte (FABP4))

Andere Bezeichnung: FABP4 (FABP4 Produkte)

Synonyme: A-FABP antikoerper, AFABP antikoerper, ALBP antikoerper, aP2 antikoerper, LOC100223994 antikoerper, FABP antikoerper, AP2 antikoerper, FABP3 antikoerper, FABP4 antikoerper, MGC84940 antikoerper, fabp4 antikoerper, 422/aP2 antikoerper, ALBP/Ap2 antikoerper, Ap2 antikoerper, Lbpl antikoerper, Albp antikoerper, fatty acid binding protein 4 antikoerper, fatty acid-binding protein, adipocyte antikoerper, fatty acid binding protein 4, adipocyte antikoerper, fatty acid binding protein 4, adipocyte L homeolog antikoerper, Fatty acid-binding protein, adipocyte antikoerper, adipocyte fatty acid-binding protein antikoerper, adipocyte fatty acid binding protein antikoerper, FABP4 antikoerper, LOC100223994 antikoerper, fabp4.L antikoerper, fabp4 antikoerper, Fabp4 antikoerper, LOC100732353 antikoerper, LOC100861279 antikoerper, LOC100057425 antikoerper, LOC395224 antikoerper

Hintergrund: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

Synonyms: 3T3-L1 lipid-binding protein antibody|422/aP2 antibody|A FABP antibody|A-FABP antibody|adipocyte antibody|Adipocyte lipid binding protein antibody|Adipocyte lipid-binding protein antibody|Adipocyte protein AP2 antibody|Adipocyte-type fatty acid-binding protein antibody|AFABP antibody|ALBP antibody|ALBP/Ap2 antibody|aP2 antibody|FABP antibody|FABP4 antibody|FABP4_HUMAN antibody|Fatty acid binding protein 4 adipocyte antibody|Fatty acid binding protein 4 antibody|Fatty acid binding protein adipocyte antibody|Fatty acid-binding protein 4 antibody|Fatty acid-binding protein antibody|Lbpl antibody|Myelin P2 protein homolog antibody|P15 antibody|P2 adipocyte protein antibody|Protein 422 antibody

Gen-ID: 2167

UniProt: P15090

Pathways: Brown Fat Cell Differentiation