NME1 Antikörper (N-Term)
-
- Target Alle NME1 Antikörper anzeigen
- NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in (NME1))
-
Bindungsspezifität
- AA 26-58, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NME1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- KRFEQKGFRL VGLKFMQASE DLLKEHYVDL KDR
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: NME/NM23 nucleoside diphosphate kinase 1
Protein Name: Nucleoside diphosphate kinase A - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product NME1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Mutation of the nm23-H1 gene has a non-dominant role in colorectal adenocarcinoma." in: Molecular and clinical oncology, Vol. 5, Issue 1, pp. 107-110, (2016) (PubMed).
: "
-
Mutation of the nm23-H1 gene has a non-dominant role in colorectal adenocarcinoma." in: Molecular and clinical oncology, Vol. 5, Issue 1, pp. 107-110, (2016) (PubMed).
-
- Target
- NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in (NME1))
- Andere Bezeichnung
- NME1 (NME1 Produkte)
- Synonyme
- AWD antikoerper, GAAD antikoerper, NB antikoerper, NBS antikoerper, NDKA antikoerper, NDPK-A antikoerper, NDPKA antikoerper, NM23 antikoerper, NM23-H1 antikoerper, AL024257 antikoerper, NM23-M1 antikoerper, NM23A antikoerper, NDPK-Z1 antikoerper, NM23-B antikoerper, NM23-Z1 antikoerper, ndpkz1 antikoerper, nm23b antikoerper, nme1 antikoerper, nme2 antikoerper, nme2b1 antikoerper, NME1 antikoerper, NME1-NME2 antikoerper, NM23-C1 antikoerper, ndpk-b antikoerper, ndpkb antikoerper, nm23-h2 antikoerper, nm23ndk antikoerper, puf antikoerper, NBR-A antikoerper, NBR-B antikoerper, NME1-1 antikoerper, nm23ndk-a antikoerper, NDK I antikoerper, NDPK I antikoerper, T30A10.80 antikoerper, T30A10_80 antikoerper, NDP kinase I antikoerper, NME/NM23 nucleoside diphosphate kinase 1 antikoerper, NME/NM23 nucleoside diphosphate kinase 2b, tandem duplicate 1 antikoerper, non-metastatic cells 1, protein (NM23A) expressed in antikoerper, NME/NM23 nucleoside diphosphate kinase 2 S homeolog antikoerper, NME/NM23 nucleoside diphosphate kinase 2 L homeolog antikoerper, nucleoside diphosphate kinase antikoerper, nucleoside diphosphate kinase 1 antikoerper, NME1 antikoerper, Nme1 antikoerper, nme2b.1 antikoerper, nme2.S antikoerper, nme2.L antikoerper, LOC547870 antikoerper, NDPK1 antikoerper, LOC107790563 antikoerper
- Hintergrund
-
NME1(NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.
Synonyms: AWD antibody|AWD, drosophila, homolog of antibody|GAAD antibody|Granzyme A activated DNase antibody|Granzyme A-activated DNase antibody|GZMA activated DNase antibody|Metastasis inhibition factor NM23 antibody|NB antibody|NBS antibody|NDK A antibody|NDKA antibody|NDKA_HUMAN antibody|NDP kinase A antibody|NDPK-A antibody|NDPKA antibody|NM23 antibody|NM23 long variant, included antibody|nm23-H1 antibody|NM23-M1 antibody|NM23H1B, included antibody|NME/NM23 nucleoside diphosphate kinase 1 antibody|Nme1 antibody|NME1-NME2 spliced read-through transcript, included antibody|Non-metastatic cells 1, protein (NM23A) expressed in antibody| Nonmetastatic cells 1, protein expressed in antibody|Nonmetastatic protein 23 antibody|Nonmetastatic protein 23, homolog 1 antibody| Nucleoside diphosphate kinase A antibody|Tumor metastatic process-associated protein antibody - Gen-ID
- 4830
- UniProt
- P15531
- Pathways
- Apoptose, Nucleotide Phosphorylation, Carbohydrate Homeostasis, Ribonucleoside Biosynthetic Process
-