Prolactin Receptor Antikörper (C-Term)

Produktnummer ABIN3043553

Produktdetails anti-Prolactin Receptor Antikörper

Target: Prolactin Receptor (PRLR)

Bindungsspezifität: AA 565-605, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Prolactin Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.

Sequenz: HAKNVACFEE SAKEAPPSLE QNQAEKALAN FTATSSKCRL Q

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Prolactin receptor(PRLR) detection. Tested with WB in Human.
Gene Name: prolactin receptor
Protein Name: Prolactin receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Prolactin Receptor Antikörper (ABIN3043553)

Zhang, Liu, Liu, Zhou, Song, Cao, An: "miR-182 aids in receptive endometrium development in dairy goats by down-regulating PTN expression." in: PLoS ONE, Vol. 12, Issue 7, pp. e0179783, (2017) (PubMed).

Details zu Prolactin Receptor

Target: Prolactin Receptor (PRLR)

Andere Bezeichnung: PRLR (PRLR Produkte)

Hintergrund: PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands.

Synonyms: AI987712 antibody|CLONE SPM213 antibody|CPRLP antibody|Delta 4-delta 7/11 truncated prolactin receptor antibody|Delta 4-SF1b truncated prolactin receptor antibody|hPRL receptor antibody|hPRLrI antibody|Lactogen receptor antibody|MGC105486 antibody|OPR antibody| OTTHUMP00000115998 antibody|Pr-1 antibody|Pr-3 antibody|PRL R antibody|PRL-R antibody|PRLR antibody|Prlr-rs1 antibody|PRLR_HUMAN antibody|Prolactin receptor a antibody| Prolactin receptor antibody|Prolactin receptor delta 7/11 antibody|RATPRLR antibody| Secreted prolactin binding protein antibody|Truncated testis-specific box 1-C prolactin receptor antibody|wu:fj65c07 antibody

Gen-ID: 5618

UniProt: P16471

Pathways: JAK-STAT Signalweg, Response to Growth Hormone Stimulus