ARID1A Antikörper (Middle Region)

Produktnummer ABIN3043527

Produktdetails anti-ARID1A Antikörper

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Bindungsspezifität: AA 1021-1053, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARID1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.

Sequenz: KMWVDRYLAF TEEKAMGMTN LPAVGRKPLD LYR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for AT-rich interactive domain-containing protein 1A(ARID1A) detection. Tested with WB in Human.
Gene Name: AT rich interactive domain 1A (SWI-like)
Protein Name: AT-rich interactive domain-containing protein 1A

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ARID1A (1021-1053aa KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ARID1A

Target: ARID1A (AT Rich Interactive Domain 1A (SWI-Like) (ARID1A))

Andere Bezeichnung: ARID1A (ARID1A Produkte)

Synonyme: B120 antikoerper, BAF250 antikoerper, BAF250a antikoerper, BM029 antikoerper, C1orf4 antikoerper, ELD antikoerper, MRD14 antikoerper, OSA1 antikoerper, P270 antikoerper, SMARCF1 antikoerper, hELD antikoerper, hOSA1 antikoerper, 1110030E03Rik antikoerper, Osa1 antikoerper, Smarcf1 antikoerper, ARID1A antikoerper, wu:fb79b07 antikoerper, wu:fb95g08 antikoerper, zgc:171438 antikoerper, AT-rich interaction domain 1A antikoerper, AT rich interactive domain 1A (SWI-like) antikoerper, AT rich interactive domain 1Aa (SWI-like) antikoerper, ARID1A antikoerper, Arid1a antikoerper, arid1a antikoerper, arid1aa antikoerper

Hintergrund: AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

Synonyms: actin-dependent regulator of chromatin subfamily F member 1 antibody|ARI1A_HUMAN antibody| ARID domain containing protein 1A antibody|ARID domain-containing protein 1A antibody| ARID1A antibody|AT rich interactive domain 1A (SWI like) antibody|AT rich interactive domain 1A antibody|AT rich interactive domain containing protein 1A antibody|AT-rich interactive domain-containing protein 1A antibody|B120 antibody|BAF250 antibody|BAF250A antibody|BM029 antibody|brain protein 120 antibody|BRG1 associated factor 250 antibody|BRG1 associated factor 250a antibody|BRG1-associated factor 250 antibody|BRG1-associated factor 250a antibody|C1ORF4 antibody|chromatin remodeling factor p250 antibody|chromosome 1 open reading frame 4 antibody|hELD antibody|hOSA1 antibody|matrix-associated antibody|Osa homolog 1 antibody|OSA1 antibody|OSA1 nuclear protein antibody|P270 antibody|SMARCF1 antibody|SWI like protein antibody|SWI SNF complex protein p270 antibody|SWI-like protein antibody|SWI/SNF complex protein p270 antibody|SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1 antibody|SWI/SNF-related antibody

Gen-ID: 8289

UniProt: O14497

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Tube Formation