TAP2 Antikörper (C-Term)

Produktnummer ABIN3043415

Produktdetails anti-TAP2 Antikörper

Target: TAP2 (Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2))

Bindungsspezifität: AA 611-651, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.

Sequenz: QKQRLAIARA LVRDPRVLIL DEATSALDVQ CEQALQDWNS R

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Antigen peptide transporter 2(TAP2) detection. Tested with WB in Human.
Gene Name: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name: Antigen peptide transporter 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TAP2

Target: TAP2 (Transporter 2, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP2))

Andere Bezeichnung: TAP2 (TAP2 Produkte)

Synonyme: ABC18 antikoerper, ABCB3 antikoerper, APT2 antikoerper, D6S217E antikoerper, PSF-2 antikoerper, PSF2 antikoerper, RING11 antikoerper, AI462429 antikoerper, Abcb3 antikoerper, Ham-2 antikoerper, Ham2 antikoerper, MTP2 antikoerper, Tap-2 antikoerper, Y1 antikoerper, jas antikoerper, Cim antikoerper, transporter 2, ATP binding cassette subfamily B member antikoerper, transporter 2, ATP-binding cassette, sub-family B (MDR/TAP) antikoerper, TAP2 antikoerper, Tap2 antikoerper

Hintergrund: Transporter, ATP-binding cassette, major histocompatibility complex 2(TAP2) is a gene in humans that encodes the protein Antigen peptide transporter 2. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. The gene is assigned to human chromosome 6p21.3. It is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. And this protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum.

Synonyms: ABC transporter, MHC 2 antibody|ABC18 antibody|ABCB3 antibody|Antigen peptide transporter 2 antibody|APT2 antibody|ATP binding cassette, sub family B (MDR/TAP), member 3 antibody|D6S217E antibody|Peptide supply factor 2 antibody|Peptide transporter involved in antigen processing 2 antibody|Peptide transporter PSF2 antibody|Peptide transporter TAP2 antibody|PSF 2 antibody|PSF2 antibody|Really interesting new gene 11 protein antibody|RING 11 antibody|RING11 antibody|TAP 2 antibody|Transporter 2 ATP binding cassette sub family B antibody|Transporter 2, ABC (ATP binding cassette antibody|Transporter 2, ATP binding cassette, sub family B (MDR/TAP) antibody

Gen-ID: 6891

UniProt: Q03519

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process