LIFR Antikörper (C-Term)

Produktnummer ABIN3043410

Produktdetails anti-LIFR Antikörper

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Bindungsspezifität: AA 863-899, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIFR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.

Sequenz: EWIKETFYPD IPNPENCKAL QFQKSVCEGS SALKTLE

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Leukemia inhibitory factor receptor(LIFR) detection. Tested with WB in Human.
Gene Name: leukemia inhibitory factor receptor alpha
Protein Name: Leukemia inhibitory factor receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR(863-899aa EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu LIFR

Target: LIFR (Leukemia Inhibitory Factor Receptor alpha (LIFR))

Andere Bezeichnung: LIFR (LIFR Produkte)

Synonyme: A230075M04Rik antikoerper, AW061234 antikoerper, LIF antikoerper, CD118 antikoerper, LIF-R antikoerper, SJS2 antikoerper, STWS antikoerper, SWS antikoerper, leukemia inhibitory factor receptor antikoerper, LIF receptor alpha antikoerper, leukemia inhibitory factor receptor alpha antikoerper, Lifr antikoerper, LOC397451 antikoerper, LIFR antikoerper

Hintergrund: LIFR also known as CD118 (Cluster of Differentiation 118), is a subunit of a receptor for leukemia inhibitory factor. This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5,8)(p13,q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.

Synonyms: CD118 antibody|CD118 antigen antibody|FLJ98106 antibody|FLJ99923 antibody|Leukemia inhibitory factor receptor alpha antibody|Leukemia inhibitory factor receptor antibody|LIF R antibody|LIF receptor antibody|LIF-R antibody|Lifr antibody|LIFR_HUMAN antibody|SJS2 antibody|STWS antibody|SWS antibody

Gen-ID: 3977

UniProt: P42702

Pathways: JAK-STAT Signalweg, Growth Factor Binding