LGALS8 Antikörper (C-Term)
-
- Target Alle LGALS8 Antikörper anzeigen
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
-
Bindungsspezifität
- AA 286-317, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LGALS8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
- Sequenz
- HSLEYKHRFK ELSSIDTLEI NGDIHLLEVR SW
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human,Rat.
Gene Name: lectin, galactoside-binding, soluble, 8
Protein Name: Galectin-8 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product LGALS8 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))
- Andere Bezeichnung
- LGALS8 (LGALS8 Produkte)
- Synonyme
- LGALS8 antikoerper, 1200015E08Rik antikoerper, AI326142 antikoerper, D13Ertd524e antikoerper, Lgals-8 antikoerper, galectin-8 antikoerper, Gal-8 antikoerper, PCTA-1 antikoerper, PCTA1 antikoerper, Po66-CBP antikoerper, xgalectin-VIIIa antikoerper, galectin 8 antikoerper, lectin, galactose binding, soluble 8 antikoerper, lectin, galactoside binding soluble 8 S homeolog antikoerper, LGALS8 antikoerper, Lgals8 antikoerper, lgals8.S antikoerper
- Hintergrund
-
Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: Gal 8 antibody|Gal-8 antibody|Gal8 antibody|Galectin-8 antibody|galectin-8g antibody|Lectin galactoside binding soluble 8 antibody| LEG8_HUMAN antibody|LGAL S8 antibody|Lgals8 antibody|PCTA 1 antibody|PCTA-1 antibody|PCTA1 antibody|Po66 carbohydrate binding protein antibody|Po66 carbohydrate-binding protein antibody|Po66 CBP antibody|Po66-CBP antibody|Prostate carcinoma tumor antigen 1 antibody - Gen-ID
- 3964
- UniProt
- O00214
-