TGFBR1 Antikörper (N-Term)

Produktnummer ABIN3043310

Produktdetails anti-TGFBR1 Antikörper

Target: TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))

Bindungsspezifität: AA 149-186, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGFBR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.

Sequenz: HNRTVIHHRV PNEEDPSLDR PFISEGTTLK DLIYDMTT

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.
Gene Name: transforming growth factor, beta receptor 1
Protein Name: TGF-beta receptor type-1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-TGFBR1 Antikörper (ABIN3043310)

Wang, Qin, Deng, Yao: "Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." in: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).

Li, Yang: "[Effect of interferon-α on rat liver fibrosis induced by CCl(4)]." in: Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences, Vol. 36, Issue 3, pp. 243-8, (2012) (PubMed).

Wei, Lu, Li, Zhan, Wang, Huang: "The expression of AT1 receptor on hepatic stellate cells in rat fibrosis induced by CCl4." in: Chinese medical journal, Vol. 114, Issue 6, pp. 583-7, (2002) (PubMed).

Details zu TGFBR1

Target: TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))

Andere Bezeichnung: TGFBR1 (TGFBR1 Produkte)

Synonyme: AAT5 antikoerper, ACVRLK4 antikoerper, ALK-5 antikoerper, ALK5 antikoerper, LDS1A antikoerper, LDS2A antikoerper, MSSE antikoerper, SKR4 antikoerper, TGFR-1 antikoerper, aat5 antikoerper, acvrlk4 antikoerper, alk-5 antikoerper, alk5 antikoerper, lds1a antikoerper, lds2a antikoerper, skr4 antikoerper, tgfr-1 antikoerper, TGFBR1 antikoerper, x-trr1 antikoerper, AU017191 antikoerper, Alk-5 antikoerper, TbetaR-I antikoerper, TbetaRI antikoerper, Alk5 antikoerper, Skr4 antikoerper, Tgfr-1 antikoerper, tbetaR-I antikoerper, tgfbr1 antikoerper, zgc:123263 antikoerper, transforming growth factor beta receptor 1 antikoerper, transforming growth factor beta receptor I antikoerper, transforming growth factor beta receptor I S homeolog antikoerper, transforming growth factor, beta receptor I antikoerper, transforming growth factor, beta receptor 1 antikoerper, transforming growth factor, beta receptor 1 a antikoerper, TGFBR1 antikoerper, tgfbr1 antikoerper, tgfbr1.S antikoerper, Tgfbr1 antikoerper, tgfbr1a antikoerper

Hintergrund: Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.

Synonyms: AAT 5 antibody|AAT5 antibody|Activin A receptor type II like kinase 53 kDa antibody|Activin A receptor type II like kinase, 53kD antibody|Activin A receptor type II like protein kinase of 53kD antibody|activin A receptor type II-like kinase, 53 kDa antibody| activin A receptor type II-like protein kinase of 53kD antibody|Activin receptor like kinase 5 antibody|Activin receptor-like kinase 5 antibody|ACVRLK 4 antibody|ACVRLK4 antibody|ALK 5 antibody|ALK-5 antibody|ALK5 antibody|LDS1A antibody|LDS2A antibody|MSSE antibody| Serine/threonine protein kinase receptor R4 antibody|Serine/threonine-protein kinase receptor R4 antibody|SKR 4 antibody|SKR4 antibody|TbetaR I antibody|TbetaR-I antibody|TGF beta receptor type 1 antibody|TGF beta receptor type I antibody|TGF beta type I receptor antibody|TGF-beta receptor type I antibody|TGF-beta receptor type-1 antibody|TGF-beta type I receptor antibody|TGFBR 1 antibody|TGFBR1 antibody|TGFBR1 protein antibody|TGFR 1 antibody|TGFR-1 antibody|TGFR1 antibody|TGFR1_HUMAN antibody|Transforming growth factor beta receptor 1 antibody|Transforming growth factor beta receptor I (activin A receptor type II like kinase, 53kD) antibody|Transforming growth factor beta receptor I antibody|transforming growth factor, beta receptor 1 antibody|transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD) antibody|Transforming growth factor-beta receptor type I antibody

Gen-ID: 7046

UniProt: P36897

Pathways: Growth Factor Binding