IGFBP5 Antikörper (N-Term)
-
- Target Alle IGFBP5 Antikörper anzeigen
- IGFBP5 (Insulin-Like Growth Factor Binding Protein 5 (IGFBP5))
-
Bindungsspezifität
- AA 76-114, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IGFBP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.
- Sequenz
- QGLRCLPRQD EEKPLHALLH GRGVCLNEKS YREQVKIER
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.
Gene Name: insulin-like growth factor binding protein 5
Protein Name: Insulin-like growth factor-binding protein 5 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product IGFBP5 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
The effects of HIF-1alpha on gene expression profiles of NCI-H446 human small cell lung cancer cells." in: Journal of experimental & clinical cancer research : CR, Vol. 28, pp. 150, (2010) (PubMed).
: "Expressions of IGFBP-5, cFLIP in cervical intraepithelial neoplasia, cervical carcinoma and their clinical significances: a molecular pathology." in: Journal of experimental & clinical cancer research : CR, Vol. 28, pp. 70, (2009) (PubMed).
: "
-
The effects of HIF-1alpha on gene expression profiles of NCI-H446 human small cell lung cancer cells." in: Journal of experimental & clinical cancer research : CR, Vol. 28, pp. 150, (2010) (PubMed).
-
- Target
- IGFBP5 (Insulin-Like Growth Factor Binding Protein 5 (IGFBP5))
- Andere Bezeichnung
- IGFBP5 (IGFBP5 Produkte)
- Synonyme
- IBP5 antikoerper, AI256729 antikoerper, AW208790 antikoerper, IGFBP-5 antikoerper, IGFBP-5P antikoerper, IGF-BP5 antikoerper, igfbp5 antikoerper, ibp5 antikoerper, IBP-5 antikoerper, xIGFBP-5 antikoerper, IGFBP5 antikoerper, igfbp5b antikoerper, zgc:165472 antikoerper, insulin like growth factor binding protein 5 antikoerper, insulin-like growth factor binding protein 5 antikoerper, insulin like growth factor binding protein 5 L homeolog antikoerper, insulin-like growth factor binding protein 5b antikoerper, insulin-like growth factor-binding protein 5 antikoerper, insulin-like growth factor binding protein 5a antikoerper, IGFBP5 antikoerper, Igfbp5 antikoerper, igfbp5.L antikoerper, igfbp5b antikoerper, igfbp5 antikoerper, LOC100194500 antikoerper, igfbp5a antikoerper
- Hintergrund
-
Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by the IGFBP5 gene. The expression of IGFBP5 by stable transfection and adenovirus-mediated infection is inhibitory to growth in 2 human breast cancer cell lines. IGFBP5 expression leads to G2/M cell cycle arrest and apoptosis. Stable expression of IGFBP5 in the breast cancer cell lines also inhibits the formation and growth of tumors following injection in athymic mice. It is concluded that IGFBP5 is a growth inhibitor and proapoptotic agent in breast cancer cells. Additionally, IGFBP-5 is expressed by fibroblasts, myoblasts and osteoblasts, making it the predominant IGFBP found in bone extracts. It has a strong affinity for hydroxyapatite, allowing it to bind to bone cells. When bound to extracellular matrix, IGFBP-5 is protected from proteolysis and potentiates IGF activity, but when it is soluble, IGFBP-5 is cleaved to a biologically inactive 21 kDa fragment (1, 2).
Synonyms: IBP 5 antibody|IBP-5 antibody|IBP5 antibody|IBP5_HUMAN antibody|IGF binding protein 5 antibody|IGF BP5 antibody|IGF-binding protein 5 antibody|IGFBP 5 antibody|IGFBP-5 antibody|IGFBP5 antibody|Insulin like growth factor binding protein 5 antibody|Insulin-like growth factor-binding protein 5 antibody - Gen-ID
- 3488
- UniProt
- P24593
- Pathways
- WNT Signalweg, Carbohydrate Homeostasis, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process, Autophagie, Smooth Muscle Cell Migration, Growth Factor Binding
-