ICA1 Antikörper (Middle Region)

Produktnummer ABIN3042731

Produktdetails anti-ICA1 Antikörper

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Bindungsspezifität: AA 243-276, Middle Region

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ICA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: EKTSHTMAAI HESFKGYQPY EFTTLKSLQD PMKK

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: islet cell autoantigen 1, 69 kDa
Protein Name: Islet cell autoantigen 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ICA1

Target: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Andere Bezeichnung: ICA1 (ICA1 Produkte)

Synonyme: ica1 antikoerper, MGC52730 antikoerper, ICA1 antikoerper, DKFZp469G0321 antikoerper, zgc:92566 antikoerper, 69kDa antikoerper, ICA69 antikoerper, Ica69 antikoerper, MGC83241 antikoerper, ICAp69 antikoerper, islet cell autoantigen 1 L homeolog antikoerper, islet cell autoantigen 1 antikoerper, Islet cell autoantigen 1 antikoerper, islet cell autoantigen 1 S homeolog antikoerper, ica1.L antikoerper, ICA1 antikoerper, ica1 antikoerper, ica69 antikoerper, Ica1 antikoerper, ica1.S antikoerper

Hintergrund: Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What's more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Synonyms: 69 kDa islet cell autoantigen antibody|Diabetes mellitus type I autoantigen antibody|ICA 1 antibody|Ica1 antibody|ICA69 antibody|ICA69_HUMAN antibody|ICAp69 antibody|Islet cell autoantigen 1 (69kD) antibody|Islet cell autoantigen 1 69 kDa antibody|Islet cell autoantigen 1 antibody|Islet cell autoantigen 1 isoform antibody|Islet cell autoantigen p69 antibody|OTTHUMP00000200933 antibody|OTTHUMP00000200934 antibody|OTTHUMP00000200941 antibody|OTTHUMP00000200993 antibody|p69 antibody

Gen-ID: 3382

UniProt: Q05084