SP1 Antikörper (C-Term)

Produktnummer ABIN3042489

Produktdetails anti-SP1 Antikörper

Target: SP1 (Sp1 Transcription Factor (SP1))

Bindungsspezifität: AA 752-785, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Transcription factor Sp1(SP1) detection. Tested with WB in Human.

Sequenz: EAICPEGIAR LANSGINVMQ VADLQSINIS GNGF

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Transcription factor Sp1(SP1) detection. Tested with WB in Human.
Gene Name: Sp1 transcription factor
Protein Name: Transcription factor Sp1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for SP1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-SP1 Antikörper (ABIN3042489)

Zhang, Liu, Liu, Zhou, Song, Cao, An: "miR-182 aids in receptive endometrium development in dairy goats by down-regulating PTN expression." in: PLoS ONE, Vol. 12, Issue 7, pp. e0179783, (2017) (PubMed).

Details zu SP1

Target: SP1 (Sp1 Transcription Factor (SP1))

Andere Bezeichnung: SP1 (SP1 Produkte)

Synonyme: fc18h09 antikoerper, zgc:85950 antikoerper, wu:fc18h09 antikoerper, SP1 antikoerper, 1110003E12Rik antikoerper, AA450830 antikoerper, AI845540 antikoerper, Sp1-1 antikoerper, sp1 transcription factor antikoerper, Sp1 transcription factor antikoerper, Sp1 transcription factor L homeolog antikoerper, trans-acting transcription factor 1 antikoerper, sp1 antikoerper, SP1 antikoerper, Sp1 antikoerper, sp1.L antikoerper

Hintergrund: SP1(transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.

Synonyms: SP 1 antibody|SP1 antibody|Sp1 transcription factor antibody|SP1_HUMAN antibody|Specificity protein 1 antibody|Transcription factor Sp1 antibody|TSFP 1 antibody|TSFP1 antibody

Gen-ID: 6667

UniProt: P08047

Pathways: Regulation of Lipid Metabolism by PPARalpha, Myometrial Relaxation and Contraction