FABP1 Antikörper (N-Term)

Produktnummer ABIN3042384

Produktdetails anti-FABP1 Antikörper

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Bindungsspezifität: AA 6-36, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KYQLQSQENF EAFMKAIGLP EELIQKGKDI K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, liver(FABP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fatty acid binding protein 1, liver
Protein Name: Fatty acid-binding protein, liver

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu FABP1

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Andere Bezeichnung: FABP1 (FABP1 Produkte)

Synonyme: FABPL antikoerper, L-FABP antikoerper, KAT4 antikoerper, KATIV antikoerper, mitAAT antikoerper, Fabpl antikoerper, Fabplg antikoerper, SCP antikoerper, SCP. antikoerper, p14 antikoerper, FABP1 antikoerper, FABP antikoerper, LFABP antikoerper, liver antikoerper, fabp1 antikoerper, Fabp1 antikoerper, FABP-1 antikoerper, FABPpm antikoerper, mAspAT antikoerper, fatty acid binding protein 1 antikoerper, glutamic-oxaloacetic transaminase 2 antikoerper, fatty acid binding protein 1, liver antikoerper, fatty acid binding protein 1a, liver antikoerper, fatty acid-binding protein, liver antikoerper, FABP1 antikoerper, GOT2 antikoerper, Fabp1 antikoerper, fabp1a antikoerper, LOC100726384 antikoerper

Hintergrund: Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

Synonyms: FABP 1 antibody|FABP1 antibody|FABP-1 antibody|FABPL antibody|FABPL_HUMAN antibody|Fatty Acid Binding Protein 1 antibody|Fatty acid binding protein 1 liver antibody|Fatty Acid Binding Protein antibody|Fatty acid-binding protein 1 antibody|Fatty acid-binding protein antibody|Fatty acid-binding protein liver antibody|L FABP antibody|L-FABP antibody|liver antibody|Liver-type fatty acid-binding protein antibody

Gen-ID: 2168

UniProt: P07148

Pathways: Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha