F2RL1 Antikörper (C-Term)
-
- Target Alle F2RL1 Antikörper anzeigen
- F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))
-
Bindungsspezifität
- AA 349-383, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser F2RL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.
- Sequenz
- HDFRDHAKNA LLCRSVRTVK QMQVSLTSKK HSRKS
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.
Gene Name: coagulation factor II (thrombin) receptor-like 1
Protein Name: Proteinase-activated receptor 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product F2RL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Effect and mechanism of PAR-2 on the proliferation of esophageal cancer cells." in: European review for medical and pharmacological sciences, Vol. 20, Issue 22, pp. 4688-4696, (2017) (PubMed).
: "
-
Effect and mechanism of PAR-2 on the proliferation of esophageal cancer cells." in: European review for medical and pharmacological sciences, Vol. 20, Issue 22, pp. 4688-4696, (2017) (PubMed).
-
- Target
- F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))
- Andere Bezeichnung
- F2RL1 (F2RL1 Produkte)
- Synonyme
- par2 antikoerper, GPR11 antikoerper, PAR2 antikoerper, Gpcr11 antikoerper, PAR-2 antikoerper, Par2 antikoerper, Par-2 antikoerper, Proteinase-activated receptor 2 antikoerper, F2R like trypsin receptor 1 antikoerper, coagulation factor II (thrombin) receptor-like 1 antikoerper, par2 antikoerper, F2RL1 antikoerper, F2rl1 antikoerper
- Hintergrund
-
Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
Synonyms: Coagulation factor II receptor like 1 antibody|Coagulation factor II receptor-like 1 antibody|Coagulation factor II thrombin receptor like 1 antibody|F2RL1 antibody|G protein coupled receptor 11 antibody|G-protein coupled receptor 11 antibody|GPR11 antibody|PAR 2 antibody|PAR-2 antibody|PAR2_HUMAN antibody|Protease activated receptor 2 antibody| Proteinase activated receptor 2 antibody| Proteinase-activated receptor 2 antibody|Thrombin receptor like 1 antibody|Thrombin receptor-like 1 antibody - Gen-ID
- 2150
- UniProt
- P55085
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interaktom
-