F2RL1 Antikörper (C-Term)

Produktnummer ABIN3042381

Produktdetails anti-F2RL1 Antikörper

Target: F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))

Bindungsspezifität: AA 349-383, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser F2RL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.

Sequenz: HDFRDHAKNA LLCRSVRTVK QMQVSLTSKK HSRKS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.
Gene Name: coagulation factor II (thrombin) receptor-like 1
Protein Name: Proteinase-activated receptor 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-F2RL1 Antikörper (ABIN3042381)

Quanjun, Qingyu, Qiliang, Liqun, Jinmei, Ziquan, Shike: "Effect and mechanism of PAR-2 on the proliferation of esophageal cancer cells." in: European review for medical and pharmacological sciences, Vol. 20, Issue 22, pp. 4688-4696, (2017) (PubMed).

Details zu F2RL1

Target: F2RL1 (Coagulation Factor II (thrombin) Receptor-Like 1 (F2RL1))

Andere Bezeichnung: F2RL1 (F2RL1 Produkte)

Synonyme: par2 antikoerper, GPR11 antikoerper, PAR2 antikoerper, Gpcr11 antikoerper, PAR-2 antikoerper, Par2 antikoerper, Par-2 antikoerper, Proteinase-activated receptor 2 antikoerper, F2R like trypsin receptor 1 antikoerper, coagulation factor II (thrombin) receptor-like 1 antikoerper, par2 antikoerper, F2RL1 antikoerper, F2rl1 antikoerper

Hintergrund: Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.

Synonyms: Coagulation factor II receptor like 1 antibody|Coagulation factor II receptor-like 1 antibody|Coagulation factor II thrombin receptor like 1 antibody|F2RL1 antibody|G protein coupled receptor 11 antibody|G-protein coupled receptor 11 antibody|GPR11 antibody|PAR 2 antibody|PAR-2 antibody|PAR2_HUMAN antibody|Protease activated receptor 2 antibody| Proteinase activated receptor 2 antibody| Proteinase-activated receptor 2 antibody|Thrombin receptor like 1 antibody|Thrombin receptor-like 1 antibody

Gen-ID: 2150

UniProt: P55085

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interaktom