PAR1 Antikörper (N-Term)

Produktnummer ABIN3042380

Produktdetails anti-PAR1 Antikörper

Target: PAR1 (F2R) (Coagulation Factor II (thrombin) Receptor (F2R))

Bindungsspezifität: AA 46-82, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human.

Sequenz: RNPNDKYEPF WEDEEKNESG LTEYRLVSIN KSSPLQK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 1(F2R) detection. Tested with WB, IHC-P in Human.
Gene Name: coagulation factor II (thrombin) receptor
Protein Name: Proteinase-activated receptor 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PAR1

Target: PAR1 (F2R) (Coagulation Factor II (thrombin) Receptor (F2R))

Andere Bezeichnung: F2R (F2R Produkte)

Synonyme: CF2R antikoerper, HTR antikoerper, PAR-1 antikoerper, PAR1 antikoerper, TR antikoerper, Par1 antikoerper, TRGPC antikoerper, AI482343 antikoerper, Cf2r antikoerper, ThrR antikoerper, Par-1 antikoerper, f2r-a antikoerper, par1 antikoerper, coagulation factor II thrombin receptor antikoerper, coagulation factor II (thrombin) receptor antikoerper, coagulation factor 2 (thrombin) receptor L homeolog antikoerper, F2R antikoerper, F2r antikoerper, f2r.L antikoerper

Hintergrund: Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.

Synonyms: CF2R antibody|Coagulation factor II (thrombin) receptor antibody|Coagulation factor II receptor antibody|F2R antibody|HTR antibody|PAR 1 antibody|PAR-1 antibody|PAR1 antibody|PAR1_HUMAN antibody|Protease activated receptor 1 antibody|Proteinase activated receptor 1 antibody|Proteinase-activated receptor 1 antibody|Thrombin receptor antibody|TR antibody

Gen-ID: 2149

UniProt: P25116

Pathways: Nuclear Receptor Transcription Pathway, Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus