WNT7A Antikörper (C-Term)

Produktnummer ABIN3042348

Produktdetails anti-WNT7A Antikörper

Target: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Bindungsspezifität: AA 226-256, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: YVLKDKYNEA VHVEPVRASR NKRPTFLKIK K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: wingless-type MMTV integration site family, member 7A
Protein Name: Protein Wnt-7a

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu WNT7A

Target: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Andere Bezeichnung: WNT7A (WNT7A Produkte)

Synonyme: wnt7a antikoerper, AI849442 antikoerper, Wnt-7a antikoerper, px antikoerper, tw antikoerper, Xwnt-7a antikoerper, wnt-7a antikoerper, wnt7a-A antikoerper, Wnt family member 7A antikoerper, wingless-type MMTV integration site family, member 7Aa antikoerper, wingless-type MMTV integration site family, member 7A antikoerper, wingless-type MMTV integration site family member 7A S homeolog antikoerper, WNT7A antikoerper, wnt7aa antikoerper, Wnt7a antikoerper, wnt7a.S antikoerper

Hintergrund: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.

Synonyms: Protein Wnt-7a antibody|Protein Wnt-7a precursor antibody|Proto oncogene Wnt7a protein antibody|proto-oncogene wnt7a protein antibody| wingless-type MMTV integration site family, member 7A antibody|WNT7A antibody|WNT7A_HUMAN antibody

Gen-ID: 7476

UniProt: O00755

Pathways: WNT Signalweg, Stem Cell Maintenance, Asymmetric Protein Localization