TSG101 Antikörper (C-Term)
-
- Target Alle TSG101 Antikörper anzeigen
- TSG101 (Tumor Susceptibility Gene 101 (TSG101))
-
Bindungsspezifität
- AA 361-390, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TSG101 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human,Rat.
- Sequenz
- KHVRLLSRKQ FQLRALMQKA RKTAGLSDLY
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human,Rat.
Gene Name: tumor susceptibility 101
Protein Name: Tumor susceptibility gene 101 protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product TSG101 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TSG101 (Tumor Susceptibility Gene 101 (TSG101))
- Andere Bezeichnung
- TSG101 (TSG101 Produkte)
- Synonyme
- CG9712 antikoerper, DmTSG101 antikoerper, Dmel\\CG9712 antikoerper, ESCRT-I antikoerper, Tsg101 antikoerper, burs antikoerper, dTSg101 antikoerper, dTsg101 antikoerper, dVps23 antikoerper, ept antikoerper, tsg101 antikoerper, vps23 antikoerper, TSG101 antikoerper, MGC76193 antikoerper, TSG10 antikoerper, VPS23 antikoerper, AI255943 antikoerper, CC2 antikoerper, Rw antikoerper, zgc:86926 antikoerper, tumor susceptibility 101 antikoerper, Tumor susceptibility gene 101 antikoerper, Tumor Susceptibility Gene homolog antikoerper, tumor susceptibility gene 101 antikoerper, tumor susceptibility 101a antikoerper, tumor susceptibility 101 L homeolog antikoerper, TSG101 antikoerper, tsg-101 antikoerper, tsg101 antikoerper, Tsg101 antikoerper, tsg101a antikoerper, tsg101.L antikoerper
- Hintergrund
-
TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Synonyms: ESCRT I complex subunit TSG101 antibody|ESCRT-I complex subunit TSG101 antibody|TS101_HUMAN antibody|TSG 10 antibody|TSG 101 antibody||TSG10 antibody|Tsg101 antibody|Tumor susceptibility gene 10 antibody|Tumor susceptibility gene 101 antibody|Tumor susceptibility gene 101 protein antibody|Tumor susceptibility protein antibody|Tumor susceptibility protein isoform 3 antibody|VPS 23 antibody|VPS23 antibody - Gen-ID
- 7251
- UniProt
- Q99816
-