ACTH Antikörper (Middle Region)

Produktnummer ABIN3029882

Produktdetails anti-ACTH Antikörper

Target: ACTH (Adrenocorticotropic hormone (ACTH))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTH Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ACTH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ACTH

Target: ACTH (Adrenocorticotropic hormone (ACTH))

Andere Bezeichnung: ACTH (ACTH Produkte)

Synonyme: ACTH antikoerper, BE antikoerper, Beta-LPH antikoerper, Clip antikoerper, Gamma-LPH antikoerper, Npp antikoerper, Pomc-1 antikoerper, Pomc1 antikoerper, alpha-MSH antikoerper, alphaMSH antikoerper, beta-MSH antikoerper, gamma-MSH antikoerper, CLIP antikoerper, LPH antikoerper, MSH antikoerper, NPP antikoerper, POC antikoerper, pro-opiomelanocortin-alpha antikoerper, proopiomelanocortin antikoerper, Pomc antikoerper, POMC antikoerper

Substanzklasse: Hormone

Hintergrund: Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

Gen-ID: 5443

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity