FZD10 Antikörper
-
- Target Alle FZD10 Antikörper anzeigen
- FZD10 (Frizzled Family Receptor 10 (FZD10))
-
Reaktivität
- Human, Schwein
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FZD10 Antikörper ist unkonjugiert
-
Applikation
- Immunofluorescence (IF)
- Spezifität
- Human FZD10 / Frizzled 10
- Aufreinigung
- Immunoaffinity purified
- Immunogen
-
The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%), Dog, Horse, Mouse, Bovine (92%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product FZD10 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Distilled water
- Konzentration
- Lot specific
- Buffer
- Lyophilized from PBS, 2 % sucrose.
- Handhabung
- Avoid freeze-thaw cycles.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- FZD10 (Frizzled Family Receptor 10 (FZD10))
- Andere Bezeichnung
- FZD10 / Frizzled 10 (FZD10 Produkte)
- Synonyme
- CD350 antikoerper, FZ-10 antikoerper, Fz10 antikoerper, FzE7 antikoerper, hFz10 antikoerper, cFz-10 antikoerper, Fz-10 antikoerper, Xfr9 antikoerper, Xfz10 antikoerper, frizzled-10 antikoerper, frizzled10 antikoerper, fz10 antikoerper, fze7 antikoerper, hfz10 antikoerper, fk48e04 antikoerper, fz4 antikoerper, fzb antikoerper, wu:fk48e04 antikoerper, zg04 antikoerper, Xfz10A antikoerper, fzd10a antikoerper, Xfz10B antikoerper, Xfz9 antikoerper, fzd10b antikoerper, fzd9 antikoerper, frizzled class receptor 10 antikoerper, frizzled class receptor 10 L homeolog antikoerper, frizzled class receptor 10 S homeolog antikoerper, FZD10 antikoerper, fzd10 antikoerper, Fzd10 antikoerper, fzd10.L antikoerper, fzd10.S antikoerper
- Hintergrund
-
Name/Gene ID: FZD10
Subfamily: Frizzled
Family: GPCR
Synonyms: FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10 - Gen-ID
- 11211
- Pathways
- WNT Signalweg
-