anti-Human SLC2A4RG Antikörper für Immunocytochemistry

Recommended SLC2A4RG Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
SLC2A4 Regulator (SLC2A4RG) Antikörper
  • SLC2A4RG
  • GEF
  • HDBP-1
  • HDBP1
  • Si-1-2
  • Si-1-2-19
  • SLC2A4 regulator
  • SLC2A4RG
Reaktivität
Human
58
4
2
2
1
1
1
1
Wirt
Kaninchen
49
9
Klonalität
Polyklonal
Konjugat
Dieser SLC2A4RG Antikörper ist unkonjugiert
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
26
25
17
13
5
4
3
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN5079690
Preis und Verfügbarkeit auf Anfrage.

General

Antigen SLC2A4 Regulator (SLC2A4RG) Antikörper
Reaktivität Human
(58), (4), (2), (2), (1), (1), (1), (1)
Wirt Kaninchen
(49), (9)
Klonalität
Polyklonal
Konjugat Dieser SLC2A4RG Antikörper ist unkonjugiert
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunocytochemistry (ICC), Immunofluorescence (IF)
(26), (25), (17), (13), (5), (4), (3), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-SLC2A4RG Antikörper

Target Details SLC2A4RG Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP
Isotyp IgG
Plasmids, Primers & others

Target Details SLC2A4RG

Produktdetails anti-SLC2A4RG Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung SLC2A4RG (SLC2A4RG Antibody Abstract)
Hintergrund Gene Symbol: SLC2A4RG
Gen-ID 56731
Pathways AMPK Signaling

Anwendungsinformationen

Produktdetails anti-SLC2A4RG Antikörper Target Details SLC2A4RG Handhabung Bilder zurück nach oben
Applikations-hinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-SLC2A4RG Antikörper Target Details SLC2A4RG Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails anti-SLC2A4RG Antikörper Target Details SLC2A4RG Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunofluorescence (IF) image for anti-SLC2A4 Regulator (SLC2A4RG) antibody (ABIN5079690) Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody - Staining of human cell l...