anti-Maus PRKAB2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended PRKAB2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) Antikörper
  • prkab2
  • MGC64365
  • PRKAB2
  • DKFZp469M1118
  • 5730553K21Rik
  • AW049591
  • BB124140
  • protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog
  • protein kinase AMP-activated non-catalytic subunit beta 2
  • protein kinase, AMP-activated, beta 2 non-catalytic subunit
  • prkab2.L
  • PRKAB2
  • prkab2
  • Prkab2
Epitop
AA 56-89, N-Term
15
11
10
5
2
2
2
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
86
38
22
4
4
4
4
3
2
1
1
1
1
Wirt
Kaninchen
59
21
6
Klonalität
Polyklonal
Konjugat
Dieser PRKAB2 Antikörper ist unkonjugiert
2
2
2
2
2
2
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
77
34
31
10
7
6
6
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN3043907
$ 280.00
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.117413 ABIN359114 EIA IHC (p) WB Rabbit Ig Fraction N-Term Anmelden zum Anzeigen Polyclonal 5
1 ABIN4952261 IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) Antikörper
Epitop AA 56-89, N-Term
(15), (11), (10), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus)
(86), (38), (22), (4), (4), (4), (4), (3), (2), (1), (1), (1), (1)
Wirt Kaninchen
(59), (21), (6)
Klonalität
Polyklonal
Konjugat Dieser PRKAB2 Antikörper ist unkonjugiert
(2), (2), (2), (2), (2), (2), (1)
Applikation Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(77), (34), (31), (10), (7), (6), (6), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-PRKAB2 Antikörper

Target Details PRKAB2 Anwendungsinformationen Handhabung Bilder
Verwendungszweck Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequenz DKEFVSWQQD LEDSVKPTQQ ARPTVIRWSE GGKE
Kreuzreaktivität (Details) No cross reactivity with other proteins.
Produktmerkmale Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Name: 5'-AMP-activated protein kinase subunit beta-2
Reinigung Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Isotyp IgG
Plasmids, Primers & others

Target Details PRKAB2

Produktdetails anti-PRKAB2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung PRKAB2 (PRKAB2 Antibody Abstract)
Hintergrund 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.

Synonyms: 5' AMP activated protein kinase beta 2 subunit antibody|5' AMP activated protein kinase subunit beta 2 antibody|5''-AMP-activated protein kinase subunit beta-2 antibody|AAKB2_HUMAN antibody|AMP activated protein kinase beta 2 non catalytic subunit antibody|AMPK beta 2 antibody|AMPK beta 2 chain antibody|AMPK subunit beta 2 antibody|AMPK subunit beta-2 antibody|MGC61468 antibody|PRKAB 2 antibody|Prkab2 antibody|Protein kinase AMP activated beta 2 non catalytic subunit antibody
Gen-ID 5565
UniProt O43741
Pathways AMPK Signaling

Anwendungsinformationen

Produktdetails anti-PRKAB2 Antikörper Target Details PRKAB2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Kommentare

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-PRKAB2 Antikörper Target Details PRKAB2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Konzentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handhabung Avoid repeated freezing and thawing.
Lagerung 4 °C/-20 °C
Informationen zur Lagerung At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Bilder

Produktdetails anti-PRKAB2 Antikörper Target Details PRKAB2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (AA 56-89), (N-Term) antibody (ABIN3043907) Anti- AMPK beta 2 Picoband antibody, IHC(P) IHC(P): Human Lung Cancer Tissue
Immunohistochemistry (IHC) image for anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (AA 56-89), (N-Term) antibody (ABIN3043907) Anti- AMPK beta 2 Picoband antibody, IHC(P) IHC(P): Mouse Intestine Tissue
Western Blotting (WB) image for anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (AA 56-89), (N-Term) antibody (ABIN3043907) anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (AA 56-89), (N-Term) antibody (Image 3)
Immunohistochemistry (IHC) image for anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) (AA 56-89), (N-Term) antibody (ABIN3043907) Anti- AMPK beta 2 Picoband antibody, IHC(P) IHC(P): Rat Intestine Tissue