anti-Human Adiponectin Receptor 2 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Adiponectin Receptor 2 Antibody (geliefert von: Anmelden zum Anzeigen )

Adiponectin Receptor 2 (ADIPOR2) Antikörper
  • MGC84736
  • paqr2
  • acdcr2
  • LOC100220214
  • ACDCR2
  • PAQR2
  • 1110001I14Rik
  • ADCR2
  • AI115388
  • AW554121
  • D6Ucla1e
  • Paqr2
  • si:ch211-281k12.9
  • zgc:136273
  • adiponectin receptor 2 L homeolog
  • adiponectin receptor 2
  • adipor2.L
  • adipor2
  • Adipor2
Dieser Adiponectin Receptor 2 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4278486
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
13.809891 ABIN461714 IHC (p) IP Rabbit AA 2-36 Anmelden zum Anzeigen Polyclonal
13.809891 ABIN4278485 IHC IHC (p) WB Goat AA 11-40, N-Term Anmelden zum Anzeigen Polyclonal
1 ABIN447411 IHC (p) IHC WB Goat IgG C-Term, AA 362-380 Anmelden zum Anzeigen Polyclonal 2
1 ABIN2477288 IHC (p) WB Goat IgG N-Term Anmelden zum Anzeigen Polyclonal 1
1 ABIN1804591 FACS IF IHC (p) WB Rabbit AA 45-72 Anmelden zum Anzeigen Polyclonal
1 ABIN1819461 IHC (p) WB Goat IgG AA 11-40 Anmelden zum Anzeigen Polyclonal
1 ABIN2961741 FACS IF IHC (p) WB Rabbit AA 50-80, Internal Region Anmelden zum Anzeigen Polyclonal


Antigen Adiponectin Receptor 2 (ADIPOR2) Antikörper
Reaktivität Human
(60), (27), (16), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(68), (7)
Konjugat Dieser Adiponectin Receptor 2 Antikörper ist unkonjugiert
(4), (4), (2), (2), (2), (2)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(62), (37), (21), (18), (17), (11), (10), (7), (3), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen

Produktdetails anti-Adiponectin Receptor 2 Antikörper

Target Details Adiponectin Receptor 2 Anwendungsinformationen Handhabung Referenzen für anti-Adiponectin Receptor 2 Antikörper (ABIN4278486) Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS
Isotyp IgG

Target Details Adiponectin Receptor 2

Produktdetails anti-Adiponectin Receptor 2 Antikörper Anwendungsinformationen Handhabung Referenzen für anti-Adiponectin Receptor 2 Antikörper (ABIN4278486) Bilder zurück nach oben
Andere Bezeichnung AdipoR2 (ADIPOR2 Antibody Abstract)
Hintergrund Gene Symbol: ADIPOR2
Gen-ID 79602
Pathways AMPK Signaling


Produktdetails anti-Adiponectin Receptor 2 Antikörper Target Details Adiponectin Receptor 2 Handhabung Referenzen für anti-Adiponectin Receptor 2 Antikörper (ABIN4278486) Bilder zurück nach oben
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Adiponectin Receptor 2 Antikörper Target Details Adiponectin Receptor 2 Anwendungsinformationen Referenzen für anti-Adiponectin Receptor 2 Antikörper (ABIN4278486) Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Referenzen für anti-Adiponectin Receptor 2 Antikörper (ABIN4278486)

Produktdetails anti-Adiponectin Receptor 2 Antikörper Target Details Adiponectin Receptor 2 Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Guan, Zhang, Zheng, Wen, Yu, Lu, Zhao: "microRNA-423-3p promotes tumor progression via modulation of AdipoR2 in laryngeal carcinoma." in: International journal of clinical and experimental pathology, Vol. 7, Issue 9, pp. 5683-91, 2014 (Probematerial (Species): Human). Weitere Details: Immunohistochemistry


Produktdetails anti-Adiponectin Receptor 2 Antikörper Target Details Adiponectin Receptor 2 Anwendungsinformationen Handhabung Referenzen für anti-Adiponectin Receptor 2 Antikörper (ABIN4278486) zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Adiponectin Receptor 2 (ADIPOR2) antibody (ABIN4278486) Immunohistochemistry-Paraffin: Adiponectin Receptor 2 Antibody [NBP1-91652] Staining ...