anti-Human NANOS3 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended NANOS3 Antibody (geliefert von: Anmelden zum Anzeigen )

Nanos Homolog 3 (NANOS3) Antikörper
  • NOS3
  • nos3
  • cb725
  • nanos
  • nanos1
  • nos1
  • nanos C2HC-type zinc finger 3
  • nanos homolog 3 (Drosophila)
  • nanos homolog 3
  • NANOS3
  • Nanos3
  • nanos3
Dieser NANOS3 Antikörper ist unkonjugiert
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4337826
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
11.414684 ABIN783156 IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
11.414684 ABIN4337827 ELISA ICC IF IHC IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN605066 IHC IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN5555038 EIA IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN1737203 IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1 ABIN2766725 IHC (p) WB Rabbit C-Term Anmelden zum Anzeigen Polyclonal 0


Antigen Nanos Homolog 3 (NANOS3) Antikörper
Reaktivität Human
(32), (15), (14)
Wirt Kaninchen
(31), (1)
Konjugat Dieser NANOS3 Antikörper ist unkonjugiert
(4), (4), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(28), (22), (7), (6), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-NANOS3 Antikörper

Target Details NANOS3 Anwendungsinformationen Handhabung Bilder
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
Plasmids, Primers & others

Target Details NANOS3

Produktdetails anti-NANOS3 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung Nanos3 (NANOS3 Antibody Abstract)
Hintergrund Gene Symbol: NANOS3
Gen-ID 342977
UniProt P60323
Pathways ACE Inhibitor Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones, Cellular Response to Molecule of Bacterial Origin, Myometrial Relaxation and Contraction, Signaling Events mediated by VEGFR1 and VEGFR2, Thromboxane A2 Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling


Produktdetails anti-NANOS3 Antikörper Target Details NANOS3 Handhabung Bilder zurück nach oben
Applikations-hinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-NANOS3 Antikörper Target Details NANOS3 Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails anti-NANOS3 Antikörper Target Details NANOS3 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Nanos Homolog 3 (NANOS3) antibody (ABIN4337826) Immunohistochemistry: Nanos3 Antibody [NBP2-38011] - Staining of human testis shows s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nanos Homolog 3 (NANOS3) antibody (ABIN4337826) Immunohistochemistry-Paraffin: Nanos3 Antibody - Staining of human testis shows high...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nanos Homolog 3 (NANOS3) antibody (ABIN4337826) Immunohistochemistry-Paraffin: Nanos3 Antibody - Staining of human endometrium shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nanos Homolog 3 (NANOS3) antibody (ABIN4337826) Immunohistochemistry-Paraffin: Nanos3 Antibody - Staining in human testis and endome...