anti-Human CYP11B2 Antikörper für Western Blotting

Recommended CYP11B2 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2) Antikörper
  • ALDOS
  • CPN2
  • CYP11B
  • CYP11BL
  • CYPXIB2
  • P-450C18
  • P450C18
  • P450aldo
  • Cpn2
  • Cyp11b
  • Cyp11b-2
  • Cp45as
  • Cyp11b3
  • RNCP45AS
  • cytochrome P450 family 11 subfamily B member 2
  • cytochrome P450, family 11, subfamily b, polypeptide 2
  • aldosterone synthase
  • cytochrome P450, family 11, subfamily B, polypeptide 2
  • cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2
  • CYP11B2
  • Cyp11b2
Epitop
Middle Region
8
8
8
6
4
2
1
1
1
Reaktivität
Human
50
31
19
1
Wirt
Kaninchen
51
2
Klonalität
Polyklonal
Konjugat
Dieser CYP11B2 Antikörper ist unkonjugiert
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
35
25
19
16
13
7
3
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN632030
$ 510.36
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
16.132376 ABIN5663908 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 0
12.250505 ABIN2776971 WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 1
10.750505 ABIN951773 EIA FACS IHC (p) WB Rabbit Ig Fraction AA 127-155, Middle Region Anmelden zum Anzeigen Polyclonal 1
10.750505 ABIN5535338 FACS IHC (p) WB Rabbit Ig Fraction AA 120-147 Anmelden zum Anzeigen Polyclonal 0
10.750505 ABIN2996082 FACS IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7.750506 ABIN4903422 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4.750506 ABIN5996084 WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
4 ABIN477465 WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
1.7505057 ABIN6674193 IHC WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN2619822 WB Rabbit Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN6579772 FACS IHC WB Rabbit IgG AA 127-155, Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN1892395 FACS IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1892396 FACS IHC ELISA WB APC Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1892397 FACS IHC ELISA WB Biotin Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1892398 FACS IHC ELISA WB FITC Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1892399 FACS IHC ELISA WB PE Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN1892400 FACS IHC ELISA WB HRP Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2619821 FACS IHC WB Rabbit IgG AA 120-147 Anmelden zum Anzeigen Polyclonal 0
1 ABIN2247574 IHC ELISA WB HRP Rabbit IgG AA 127-155, Center, Internal Region Anmelden zum Anzeigen Polyclonal 0
1 ABIN2247587 FACS IHC ELISA WB FITC Rabbit IgG AA 127-155, Center, Internal Region Anmelden zum Anzeigen Polyclonal 0

General

Antigen Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2) Antikörper
Epitop Middle Region
(8), (8), (8), (6), (4), (2), (1), (1), (1)
Reaktivität Human
(50), (31), (19), (1)
Wirt Kaninchen
(51), (2)
Klonalität
Polyklonal
Konjugat Dieser CYP11B2 Antikörper ist unkonjugiert
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Western Blotting (WB)
(35), (25), (19), (16), (13), (7), (3), (2), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-CYP11B2 Antikörper

Target Details CYP11B2 Anwendungsinformationen Handhabung Bilder
Spezifität CYP11 B2 antibody was raised against the middle region of CYP11 2
Reinigung Affinity purified
Immunogen CYP11 B2 antibody was raised using the middle region of CYP11 2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
Plasmids, Primers & others

Target Details CYP11B2

Produktdetails anti-CYP11B2 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung CYP11B2 (CYP11B2 Antibody Abstract)
Hintergrund This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
Molekulargewicht 55 kDa (MW of target protein)
Pathways ACE Inhibitor Pathway, Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process, Feeding Behaviour

Anwendungsinformationen

Produktdetails anti-CYP11B2 Antikörper Target Details CYP11B2 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

CYP11B2 Blocking Peptide, catalog no. 33R-8145, is also available for use as a blocking control in assays to test for specificity of this CYP11B2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-CYP11B2 Antikörper Target Details CYP11B2 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP10 2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-CYP11B2 Antikörper Target Details CYP11B2 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2) (Middle Region) antibody (ABIN632030) CYP11B2 antibody used at 1 ug/ml to detect target protein.